PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01249.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 269aa    MW: 30464.1 Da    PI: 7.0492
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01249.1_g00010.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.11e-131156146
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                             +g+W +eEde l++ vk++G+++W++I ++  + Rt+k+c++rw +
  Rsa1.0_01249.1_g00010.1 11 KGPWKAEEDEVLINHVKRYGPRDWSSIRSKGLLQRTGKSCRLRWVN 56
                             79*************************8887799**********87 PP

2Myb_DNA-binding45.91.3e-1467107345
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              ++++eE++  +d+  q+G++ W++Ia +++ gRt++++k++w 
  Rsa1.0_01249.1_g00010.1  67 KFSAEEEKTVIDLQSQFGNK-WARIATYLP-GRTDNDVKNFWS 107
                              79******************.*********.***********6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-21559IPR009057Homeodomain-like
PROSITE profilePS5129421.64662IPR017930Myb domain
SuperFamilySSF466895.24E-288106IPR009057Homeodomain-like
SMARTSM007177.1E-111060IPR001005SANT/Myb domain
CDDcd001674.92E-111358No hitNo description
PfamPF139216.4E-121464No hitNo description
Gene3DG3DSA:1.10.10.606.7E-1960112IPR009057Homeodomain-like
PROSITE profilePS5129418.21663114IPR017930Myb domain
SMARTSM007178.5E-1364112IPR001005SANT/Myb domain
PfamPF002499.7E-1367107IPR001005SANT/Myb domain
CDDcd001673.54E-1067106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MEAAKKEDIK KGPWKAEEDE VLINHVKRYG PRDWSSIRSK GLLQRTGKSC RLRWVNKLRP  60
NLKNGCKFSA EEEKTVIDLQ SQFGNKWARI ATYLPGRTDN DVKNFWSSRL KRLARILHNS  120
SDASSSSCLN PKPSKGKNVK PIQSQSIGFV EEETRASSSS TSKILPYSSS SADQVVDEAL  180
IRSPELGIRL ENHQPFTFGT DLDDPFFYDI LGPADSSEPL FGIPQPFFEP SPAPRRFRHV  240
SKEDEESDVF LHDFPADMFD QVDDQTTSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-28811224126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893190.0AC189319.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB036H01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009116728.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A078HUY50.0A0A078HUY5_BRANA; BnaA09g38510D protein
STRINGBra007536.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65512842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.11e-132MYB family protein